Structure of PDB 5nd8 Chain X

Receptor sequence
>5nd8X (length=87) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence]
IKKGDNVKVIAGKDKGKEGKVIATLPKKDRVVVEGVNIMKKHQGGILETE
AAIHVSNVQLLDPKTNEPTRVGYKFVRIAKKSGEEIK
3D structure
PDB5nd8 Structures and dynamics of hibernating ribosomes from Staphylococcus aureus mediated by intermolecular interactions of HPF.
ChainX
Resolution3.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna X K5 G14 K15 T26 P28 K29 I40 M41 K42 K43 H64 N76 R80 V81 V91 K96 K3 G12 K13 T24 P26 K27 I38 M39 K40 K41 H54 N66 R70 V71 V76 K81
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5nd8, PDBe:5nd8, PDBj:5nd8
PDBsum5nd8
PubMed28645916
UniProtQ2FW17|RL24_STAA8 Large ribosomal subunit protein uL24 (Gene Name=rplX)

[Back to BioLiP]