Structure of PDB 5mqf Chain X

Receptor sequence

>5mqfX (length=94) Species: 9606 (Homo sapiens)

IRPNHTIYINNMNDKIKKEELKRSLYALFSQFGHVVDIVALKTMKMRGQA
FVIFKELGSSTNALRQLQGFPFYGKPMRIQYAKTDSDIISKMRG

3D structure

• PDB: 5mqf Cryo-EM structure of a human spliceosome activated for step 2 of splicing.
• Chain: X
• Resolution: 5.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	X	N16 A45 K47 K50 R52 F56 A87 K88 S91 D92	N11 A40 K42 K45 R47 F51 A82 K83 S86 D87

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0005515 protein binding
• GO:0030619 U1 snRNA binding

Biological Process

• GO:0000398 mRNA splicing, via spliceosome
• GO:0006397 mRNA processing
• GO:0008380 RNA splicing
• GO:1903241 U2-type prespliceosome assembly

Cellular Component

• GO:0001650 fibrillar center
• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005681 spliceosomal complex
• GO:0005684 U2-type spliceosomal complex
• GO:0005685 U1 snRNP
• GO:0005686 U2 snRNP
• GO:0016607 nuclear speck
• GO:0036464 cytoplasmic ribonucleoprotein granule
• GO:0071005 U2-type precatalytic spliceosome
• GO:0071007 U2-type catalytic step 2 spliceosome
• GO:0071013 catalytic step 2 spliceosome

External links

• PDB: RCSB:5mqf, PDBe:5mqf, PDBj:5mqf
• PDBsum: 5mqf
• PubMed: 28076346
• UniProt: P08579|RU2B_HUMAN U2 small nuclear ribonucleoprotein B'' (Gene Name=SNRPB2)