Structure of PDB 5mc6 Chain X

Receptor sequence

>5mc6X (length=155) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

STELTVQSERAFQKQPHIFNNPKVKTSKRTKRWYKNAGLGFKTPKTAIEG
SYIDKKCPFTGLVSIRGKILTGTVVSTKMHRTIVIRRAYLHYIPKYNRYE
KRHKNVPVHVSPAFRVQVGDIVTVGQCRPISKTVRFNVVKVSAAAGKANK
QFAKF

3D structure

PDB

5mc6 The cryo-EM structure of a ribosome-Ski2-Ski3-Ski8 helicase complex.

Chain

Resolution

3.8 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	X	E10 P17 H18 F20 T27 S28 W34 K36 N37 A38 G39 L40 K43 K57 L63 S65 I66 R67 K69 S77 K79 M80 H81 R88 Y90 H92 P95 K96 K102 R103 H104 K105 N106 Q127 R129 P130 I131 S132 K133 T134 R136 F137	E9 P16 H17 F19 T26 S27 W33 K35 N36 A37 G38 L39 K42 K56 L62 S64 I65 R66 K68 S76 K78 M79 H80 R87 Y89 H91 P94 K95 K101 R102 H103 K104 N105 Q126 R128 P129 I130 S131 K132 T133 R135 F136

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0000462	maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:0030686	90S preribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5mc6, PDBe:5mc6, PDBj:5mc6
PDBsum	5mc6
PubMed	27980209
UniProt	P0CX47\|RS11A_YEAST Small ribosomal subunit protein uS17A (Gene Name=RPS11A)

[Back to BioLiP]