Structure of PDB 5lnk Chain X

Receptor sequence

>5lnkX (length=88) Species: 9940 (Ovis aries)

SDAPPLTLEGIKDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEI
IMAMEDEFGFEIPDIDAEKLMCPQEIVDYIADKKDVYE

3D structure

• PDB: 5lnk Atomic structure of the entire mammalian mitochondrial complex I.
• Chain: X
• Resolution: 3.9 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D43
• Catalytic site (residue number reindexed from 1): D43

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	PNS	X	D43 S44 L45	D43 S44 L45

Gene Ontology

Biological Process

• GO:0006633 fatty acid biosynthetic process

External links

• PDB: RCSB:5lnk, PDBe:5lnk, PDBj:5lnk
• PDBsum: 5lnk
• PubMed: 27595392
• UniProt: W5NQT7