Structure of PDB 5jcs Chain X

Receptor sequence
>5jcsX (length=121) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
KALKVRTSATFRLPKTLKLARAPKYASKAVPHYNRLDSYKVIEQPITSET
AMKKVEDGNILVFQVSMKANKYQIKKAVKELYEVDVLKVNTLVRPNGTKK
AYVRLTADYDALDIANRIGYI
3D structure
PDB5jcs Architecture of the Rix1-Rea1 checkpoint machinery during pre-60S-ribosome remodeling
ChainX
Resolution9.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna X T28 L38 T112 V114 T7 L17 T91 V93
BS02 rna X A23 K36 H53 N117 A2 K15 H32 N96
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:0030687 preribosome, large subunit precursor
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5jcs, PDBe:5jcs, PDBj:5jcs
PDBsum5jcs
PubMed26619264
UniProtP04456|RL25_YEAST Large ribosomal subunit protein uL23 (Gene Name=RPL25)

[Back to BioLiP]