Structure of PDB 5jbh Chain X

Receptor sequence
>5jbhX (length=71) Species: 272844 (Pyrococcus abyssi GE5) [Search protein sequence]
MAEDEGYPAEVIEIIGRTGTTGDVTQVKVRILEGRDKGRVIRRNVRGPVR
IGDILILRETEREAREIKSRR
3D structure
PDB5jbh Cryo-EM study of start codon selection during archaeal translation initiation.
ChainX
Resolution5.34 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna X R17 T20 T21 G22 D23 R70 R71 R17 T20 T21 G22 D23 R70 R71
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0006412 translation
GO:0030490 maturation of SSU-rRNA
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5jbh, PDBe:5jbh, PDBj:5jbh
PDBsum5jbh
PubMed27819266
UniProtQ8U159|RS28_PYRFU Small ribosomal subunit protein eS28 (Gene Name=rps28e)

[Back to BioLiP]