Structure of PDB 5gak Chain X

Receptor sequence
>5gakX (length=136) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
SGNGAQGTKFRISLGLPVGAIMNCADNSGARNLYIIAVKGSGSRLNRLPA
ASLGDMVMATVKKGKPELRKKVMPAIVVRQAKSWRRRDGVFLYFEDNAGV
IANPKGEMKGSAITGPVGKECADLWPRVASNSGVVV
3D structure
PDB5gak Structure of the hypusinylated eukaryotic translation factor eIF-5A bound to the ribosome.
ChainX
Resolution3.88 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna X Q7 F11 R12 P18 V19 A21 I37 V39 K40 G43 S44 R45 L46 N47 R48 L49 R70 K83 R88 F92 Q6 F10 R11 P17 V18 A20 I36 V38 K39 G42 S43 R44 L45 N46 R47 L48 R69 K82 R87 F91
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5gak, PDBe:5gak, PDBj:5gak
PDBsum5gak
PubMed26715760
UniProtP0CX41|RL23A_YEAST Large ribosomal subunit protein uL14A (Gene Name=RPL23A)

[Back to BioLiP]