Structure of PDB 5dbe Chain X

Receptor sequence

>5dbeX (length=306) Species: 71421 (Haemophilus influenzae Rd KW20)

MAIYADNSYSIGNTPLVRLKHFGHNGNVVVKIEGRNPSYSVKCRIGANMV
WQAEKDGTLTKGKEIVDATNTGIALAYVAAARGYKITLTMPETMSLERKR
LLCGLGVNLVLTEGAKGMKGAIKAEEIVDPSRYVMLKQFENPANPQIHRE
TTGPEIWKDTDGKVDVVVAGVGTGGSITGISRAIKLDFGKQITSVAVEPV
ESPVISQTLAGEEVKPGPHKIQGIGAGFIPKNLDLSIIDRVETVDSDTAL
ATARRLMAEEGILAGISSGAAVAAADRLAKLPEFADKLIVVILPSASERY
LSTALF

3D structure

• PDB: 5dbe Crystal Structure Of O-Acetylserine Sulfhydrylase From Haemophilus Influenzae In Complex With Pre-Reactive O-Acetyl Serine, Alpha-Aminoacrylate Reactionintermediate And Peptide Inhibitor At The Resolution Of 2.25A
• Chain: X
• Resolution: 2.25 Å

Enzymatic activity

• Enzyme Commision number: 2.5.1.47: cysteine synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	X	G116 A117 K118 G119 M120 K121 P223 H224 K225 A231	G114 A115 K116 G117 M118 K119 P218 H219 K220 A226
BS02	OAS	X	M96 M120 G228 A231	M94 M118 G223 A226
BS03	0JO	X	K42 T69 N72 T73 Q143 G177 T178 G179 S181 G228 S272 P299	K42 T69 N70 T71 Q138 G172 T173 G174 S176 G223 S267 P294

Gene Ontology

Molecular Function

• GO:0004124 cysteine synthase activity
• GO:0016740 transferase activity
• GO:0016765 transferase activity, transferring alkyl or aryl (other than methyl) groups
• GO:0080146 L-cysteine desulfhydrase activity

Biological Process

• GO:0006535 cysteine biosynthetic process from serine
• GO:0019344 cysteine biosynthetic process

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:5dbe, PDBe:5dbe, PDBj:5dbe
• PDBsum: 5dbe
• UniProt: P45040|CYSK_HAEIN Cysteine synthase (Gene Name=cysK)