Structure of PDB 4dp8 Chain X |
>4dp8X (length=99) Species: 3691 (Populus nigra) [Search protein sequence] |
IDVLLGADDGSLAFVPSEFSISPGEKIVFKNNAGFPHNIVFDEDSIPSGV DASKISMSEEDLLNAKGETFEVALSNKGEYSFYCSPHQGAGMVGKVTVN |
|
PDB | 4dp8 Structural comparison of the poplar plastocyanin isoforms PCa and PCb sheds new light on the role of the copper site geometry in interactions with redox partners in oxygenic photosynthesis. |
Chain | X |
Resolution | 1.07 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU1 |
X |
H37 C84 M92 |
H37 C84 M92 |
|
|
|
|