Structure of PDB 4ckv Chain X |
>4ckvX (length=94) Species: 9606 (Homo sapiens) [Search protein sequence] |
GRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPDG KRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQ |
|
PDB | 4ckv Biophysical Studies of the Induced Dimerization of Human Vegf R Receptor 1 Binding Domain by Divalent Metals Competing with Vegf-A |
Chain | X |
Resolution | 2.055 Å |
3D structure |
|
|
Enzyme Commision number |
2.7.10.1: receptor protein-tyrosine kinase. |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
X |
H147 H223 |
H16 H92 |
|
|
|