Structure of PDB 3sel Chain X

Receptor sequence

>3selX (length=71) Species: 35554 (Geobacter sulfurreducens) [Search protein sequence]

ADDIVLKAKNGDVKFPHKAHQKAVPDCKKCHEKGPGKIEGFGKEMAHGKG
CKGCHEENKKGPTKCGECHKK

3D structure

PDB

3sel Pitfalls in the interpretation of structural changes in mutant proteins from crystal structures.

Chain

Resolution

2.1 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	HEC	X	D2 I4 F15 H17 Q21 V24 C27 C30 H31	D2 I4 F15 H17 Q21 V24 C27 C30 H31
BS02	HEC	X	F15 P16 H20 G50 C51 C54 H55 N58 K60 P62	F15 P16 H20 G50 C51 C54 H55 N58 K60 P62
BS03	HEC	X	A8 K9 N10 V13 F41 G42 A46 H47 T63 K64 C65 C68 H69	A8 K9 N10 V13 F41 G42 A46 H47 T63 K64 C65 C68 H69
BS04	DXC	X	K37 F41 G50	K37 F41 G50

Gene Ontology

	Molecular Function
GO:0009055	electron transfer activity
GO:0020037	heme binding

External links