Structure of PDB 3np0 Chain X

Receptor sequence
>3np0X (length=174) Species: 9796 (Equus caballus) [Search protein sequence]
SSQIRQNYSTEVEAAVNRLVNLYLRASYTYLSLGFYFDRDDVALCGVCAF
FHELAEEKREGAERLLKMQNQRGGRALFQDLQKPSQDEWGTTLDAMKAAI
VLEKSLNQALLDLHALGSAQADPHLCDFLESHFLDEEVKLIKKMGDHLTN
IQRLVGSQAGLGEYLFERLTLKHD
3D structure
PDB3np0 Definite coordination arrangement of organometallic palladium complexes accumulated on the designed interior surface of apo-ferritin.
ChainX
Resolution1.48 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 PLL X H114 C126 H114 C126
BS02 PLL X S118 C126 S118 C126
BS03 PLL X F35 D38 C48 F35 D38 C48
BS04 PLL X C48 A49 H52 C48 A49 H52
BS05 PLL X C45 H173 C45 H173
Gene Ontology
Molecular Function
GO:0005506 iron ion binding
GO:0008198 ferrous iron binding
GO:0008199 ferric iron binding
GO:0046872 metal ion binding
Biological Process
GO:0006826 iron ion transport
GO:0006879 intracellular iron ion homeostasis
GO:0006880 intracellular sequestering of iron ion
Cellular Component
GO:0005737 cytoplasm
GO:0005764 lysosome
GO:0005776 autophagosome
GO:0031410 cytoplasmic vesicle
GO:0044754 autolysosome
GO:0070288 ferritin complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3np0, PDBe:3np0, PDBj:3np0
PDBsum3np0
PubMed20730233
UniProtP02791|FRIL_HORSE Ferritin light chain (Gene Name=FTL)

[Back to BioLiP]