Structure of PDB 3ngc Chain X

Receptor sequence

>3ngcX (length=425) Species: 29320 (Paenarthrobacter nicotinovorans)

MYDAIVVGGGFSGLKAARDLTNAGKKVLLLEGGERLGGRAYSRESRNVPG
LRVEIGGAYLHRKHHPRLAAELDRYGIPTAAASEFTSFRHRLGPTAVDQA
FPIPGSEAVAVEAATYTLLRDAHRIDLEKGLENQDLEDLDIPLNEYVDKL
DLPPVSRQFLLAWAWNMLGQPADQASALWMLQLVAAHHYSILGVVLSLDE
VFSNGSADLVDAMSQEIPEIRLQTVVTGIDQSGDVVNVTVKDGHAFQAHS
VIVATPMNTWRRIVFTPALPERRRSVIEEGHGGQGLKILIHVRGAEAGIE
CVGDGIFPTLYDYCEVSESERLLVAFTDSGSFDPTDIGAVKDAVLYYLPE
VEVLGIDYHDWIADPLFEGPWVAPRVGQFSRVHKELGEPAGRIHFVGSDV
SLEFPGYIEGALETAECAVNAILHS

3D structure

• PDB: 3ngc Crystal structure analysis of free and substrate-bound 6-hydroxy-L-nicotine oxidase from Arthrobacter nicotinovorans.
• Chain: X
• Resolution: 2.25 Å

Enzymatic activity

• Enzyme Commision number: 1.5.3.5: (S)-6-hydroxynicotine oxidase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HNL	X	N166 M167 L198 Y311 F326 W371 G406 Y407	N166 M167 L198 Y311 F326 W371 G406 Y407
BS02	FAD	X	V7 G8 G10 S12 E31 G32 G38 R39 G56 G57 A58 Y59 V225 V226 T255 P256 W361 L366 F367 P370 W371 G397 S398 Y407 I408 A411	V7 G8 G10 S12 E31 G32 G38 R39 G56 G57 A58 Y59 V225 V226 T255 P256 W361 L366 F367 P370 W371 G397 S398 Y407 I408 A411
BS03	GP7	X	F101 T115 F159 L192 V195	F101 T115 F159 L192 V195
BS04	HNH	X	F85 V195 L198 E300 Y311	F85 V195 L198 E300 Y311

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0016491 oxidoreductase activity
• GO:0018531 (S)-6-hydroxynicotine oxidase activity

Biological Process

• GO:0009820 alkaloid metabolic process
• GO:0019608 nicotine catabolic process

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:3ngc, PDBe:3ngc, PDBj:3ngc
• PDBsum: 3ngc
• PubMed: 20006620
• UniProt: Q93NH4|HLNO_PAENI (S)-6-hydroxynicotine oxidase (Gene Name=6-hlno)