Structure of PDB 3ng7 Chain X

Receptor sequence

>3ng7X (length=427) Species: 29320 (Paenarthrobacter nicotinovorans)

MYDAIVVGGGFSGLKAARDLTNAGKKVLLLEGGERLGGRAYSRESRNVPG
LRVEIGGAYLHRKHHPRLAAELDRYGIPTAAASEFTSFRHRLGPTAVDQA
FPIPGSEAVAVEAATYTLLRDAHRIDLEKGLENQDLEDLDIPLNEYVDKL
DLPPVSRQFLLAWAWNMLGQPADQASALWMLQLVAAHHYSILGVVLSLDE
VFSNGSADLVDAMSQEIPEIRLQTVVTGIDQSGDVVNVTVKDGHAFQAHS
VIVATPMNTWRRIVFTPALPERRRSVIEEGHGGQGLKILIHVRGAEAGIE
CVGDGIFPTLYDYCEVSESERLLVAFTDSGSFDPTDIGAVKDAVLYYLPE
VEVLGIDYHDWIADPLFEGPWVAPRVGQFSRVHKELGEPAGRIHFVGSDV
SLEFPGYIEGALETAECAVNAILHSHH

3D structure

• PDB: 3ng7 Crystallographic snapshots of the complete reaction cycle of nicotine degradation by an amine oxidase of the monoamine oxidase (MAO) family
• Chain: X
• Resolution: 1.95 Å

Enzymatic activity

• Enzyme Commision number: 1.5.3.5: (S)-6-hydroxynicotine oxidase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HNL	X	Y59 N166 M167 L198 Y311 F326 W371 G406 Y407	Y59 N166 M167 L198 Y311 F326 W371 G406 Y407
BS02	FAD	X	V7 G8 G10 S12 E31 G32 G38 R39 G56 G57 A58 Y59 V226 T255 P256 W361 L366 F367 P370 W371 G397 S398 G406 Y407 I408	V7 G8 G10 S12 E31 G32 G38 R39 G56 G57 A58 Y59 V226 T255 P256 W361 L366 F367 P370 W371 G397 S398 G406 Y407 I408
BS03	HNK	X	A82 S83 F85 V195 L198	A82 S83 F85 V195 L198

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0016491 oxidoreductase activity
• GO:0018531 (S)-6-hydroxynicotine oxidase activity

Biological Process

• GO:0009820 alkaloid metabolic process
• GO:0019608 nicotine catabolic process

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:3ng7, PDBe:3ng7, PDBj:3ng7
• PDBsum: 3ng7
• PubMed: 21383134
• UniProt: Q93NH4|HLNO_PAENI (S)-6-hydroxynicotine oxidase (Gene Name=6-hlno)