Structure of PDB 3kzi Chain X

Receptor sequence
>3kziX (length=35) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search protein sequence]
TITPSLKGFFIGLLSGAVVLGLTFAVLIAISQIDK
3D structure
PDB3kzi Crystal Structure of Monomeric Photosystem II from Thermosynechococcus elongatus at 3.6-A Resolution
ChainX
Resolution3.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA X L23 G26 L13 G16
BS02 BCR X T11 I12 L16 F20 T1 I2 L6 F10
Gene Ontology
Cellular Component
GO:0009523 photosystem II
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3kzi, PDBe:3kzi, PDBj:3kzi
PDBsum3kzi
PubMed20558739
UniProtQ9F1R6|PSBX_THEVB Photosystem II reaction center protein X (Gene Name=psbX)

[Back to BioLiP]