Structure of PDB 3jct Chain X

Receptor sequence

>3jctX (length=141) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

APSAKATAAKKAVVKGTNGKKALKVRTSATFRLPKTLKLARAPKYASKAV
PHYNRLDSYKVIEQPITSETAMKKVEDGNILVFQVSMKANKYQIKKAVKE
LYEVDVLKVNTLVRPNGTKKAYVRLTADYDALDIANRIGYI

3D structure

PDB

3jct Diverse roles of assembly factors revealed by structures of late nuclear pre-60S ribosomes

Chain

Resolution

3.08 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	X	N19 K21 A23 T31 R33 L34 K36 R42 A43 K45 Y46 S69 T71 K75 N91 K92 Y93 N111 T112 L113 K120 K121 Y123 R125	N18 K20 A22 T30 R32 L33 K35 R41 A42 K44 Y45 S68 T70 K74 N90 K91 Y92 N110 T111 L112 K119 K120 Y122 R124
BS02	rna	X	T18 N19 K22 T37 L38 R42 S48 K49 H53 Y54 N55 R56 K61 K89 Y93	T17 N18 K21 T36 L37 R41 S47 K48 H52 Y53 N54 R55 K60 K88 Y92

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding
GO:0019843	rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:0030687	preribosome, large subunit precursor
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:3jct, PDBe:3jct, PDBj:3jct
PDBsum	3jct
PubMed	27251291
UniProt	P04456\|RL25_YEAST Large ribosomal subunit protein uL23 (Gene Name=RPL25)