Structure of PDB 3jap Chain X

Receptor sequence

>3japX (length=144) Species: 28985 (Kluyveromyces lactis) [Search protein sequence]

GKGKPRGLNSARKLRVHRRNNRWAETTYKKRLLGTAFKSSPFGGSSHAKG
IVLEKIGIESKQPNSAIRKCVRVQLIKNGKKVTAFVPNDGCLNFVDENDE
VLLAGFGRKGKAKGDIPGVRFKVVKVSGVSLLALWKEKKEKPRS

3D structure

PDB

3jap Conformational Differences between Open and Closed States of the Eukaryotic Translation Initiation Complex.

Chain

Resolution

4.9 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	X	K3 G4 K5 P6 R7 G8 L9 N10 R13 K14 R19 R20 N22 R23 W24 A25 E26 K30 R32 F38 K39 S40 S46 S47 H48 K50 K62 Q63 N65 S66 A67 I68 R69 K70 R73 I77 K78 N89 D90 G106 F107 G108 R109 K112 A113 K114 G115 D116 P118 R121 S131 K139	K2 G3 K4 P5 R6 G7 L8 N9 R12 K13 R18 R19 N21 R22 W23 A24 E25 K29 R31 F37 K38 S39 S45 S46 H47 K49 K61 Q62 N64 S65 A66 I67 R68 K69 R72 I76 K77 N88 D89 G105 F106 G107 R108 K111 A112 K113 G114 D115 P117 R120 S130 K138

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links