Structure of PDB 3j6b Chain X

Receptor sequence
>3j6bX (length=64) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
SKNSVIKLLSTAASGYSRYISIKKGAPLVTQVRYDPVVKRHVLFKEAKKR
KVAERKPLDFLRTA
3D structure
PDB3j6b Structure of the yeast mitochondrial large ribosomal subunit.
ChainX
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna X N8 K12 G20 R23 Y24 K28 P32 T35 Q36 V37 R38 Y39 P41 K44 H46 R60 F65 L66 R67 A69 N3 K7 G15 R18 Y19 K23 P27 T30 Q31 V32 R33 Y34 P36 K39 H41 R55 F60 L61 R62 A64
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:0044391 ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3j6b, PDBe:3j6b, PDBj:3j6b
PDBsum3j6b
PubMed24675956
UniProtP36533|RM39_YEAST Large ribosomal subunit protein bL33m (Gene Name=MRPL39)

[Back to BioLiP]