Structure of PDB 3j0p Chain X

Receptor sequence
>3j0pX (length=68) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]
TLAKAGKVRKQTPKVEKKDKPRKTPKGRSYKRILYNRRYAPHILATDPKK
RKSPNWHAGKKEKMDAAA
3D structure
PDB3j0p Structure and dynamics of the Mammalian ribosomal pretranslocation complex.
ChainX
Resolution10.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna X K10 G12 K13 V14 R15 Q17 T18 K23 K24 K37 R43 R44 S59 P60 N61 W62 K66 K4 G6 K7 V8 R9 Q11 T12 K17 K18 K31 R37 R38 S53 P54 N55 W56 K60
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Fri Nov 15 21:10:33 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '3j0p', asym_id = 'X', title = 'Structure and dynamics of the Mammalian ribosomal pretranslocation complex.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='3j0p', asym_id='X', title='Structure and dynamics of the Mammalian ribosomal pretranslocation complex.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '3j0p', asym_id = 'X'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='3j0p', asym_id='X')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>