Structure of PDB 3e6z Chain X |
>3e6zX (length=80) Species: 562 (Escherichia coli) [Search protein sequence] |
MEAQPQVISATGVVKGIDLESKKITIHHDPIAAVNAPEMTMRFTITPQTK MSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ |
|
PDB | 3e6z Tryptophan Cu(I)-pi interaction fine-tunes the metal binding properties of the bacterial metallochaperone CusF |
Chain | X |
Resolution | 1.0 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU |
X |
H36 M47 M49 |
H28 M39 M41 |
|
|
|