Structure of PDB 2xb2 Chain X

Receptor sequence

>2xb2X (length=390) Species: 9606 (Homo sapiens) [Search protein sequence]

DMTKVEFETSEEVDVTPTFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQ
IIKGRDVIAQSQSGTGKTATFSISVLQCLDIQVRETQALILAPTRELAVQ
IQKGLLALGDYMNVQCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMI
RRRSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLISATL
PHEILEMTNKFMTDPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDL
YDTLTITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMPQKERESIMK
EFRSGASRVLISTDVWARGLDVPQVSLIINYDLPNNRELYIHRIGRSGRY
GRKGVAINFVKNDDIRILRDIEQYYSTQIDEMPMNVADLI

3D structure

PDB

2xb2 Insights Into the Recruitment of the Nmd Machinery from the Crystal Structure of a Core Ejc-Upf3B Complex.

Chain

Resolution

3.4 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

3.6.4.13: RNA helicase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	peptide	X	I277 R329	I256 R308
BS02	rna	X	P114 R116 G142 G143 T163 G165 R166 D169 F197 Q200 N285 T286 K287 H308 G309 R316 T334 V336	P93 R95 G121 G122 T142 G144 R145 D148 F176 Q179 N264 T265 K266 H287 G288 R295 T313 V315
BS03	peptide	X	D22 T267 D270 M403 P404 M405	D1 T246 D249 M382 P383 M384
BS04	MG	X	T89 D187	T68 D166
BS05	ANP	X	F58 K60 Q65 G85 K88 T89 A90 G340 D342 R367 R370 Y371	F37 K39 Q44 G64 K67 T68 A69 G319 D321 R346 R349 Y350

Gene Ontology

	Molecular Function
GO:0003676	nucleic acid binding
GO:0003723	RNA binding
GO:0003724	RNA helicase activity
GO:0003729	mRNA binding
GO:0004386	helicase activity
GO:0005515	protein binding
GO:0005524	ATP binding
GO:0008143	poly(A) binding
GO:0016787	hydrolase activity
GO:0016887	ATP hydrolysis activity
GO:0035368	selenocysteine insertion sequence binding
GO:0035613	RNA stem-loop binding
GO:0043021	ribonucleoprotein complex binding

	Biological Process
GO:0000184	nuclear-transcribed mRNA catabolic process, nonsense-mediated decay
GO:0000398	mRNA splicing, via spliceosome
GO:0006364	rRNA processing
GO:0006397	mRNA processing
GO:0006406	mRNA export from nucleus
GO:0006417	regulation of translation
GO:0008306	associative learning
GO:0008380	RNA splicing
GO:0010629	negative regulation of gene expression
GO:0014070	response to organic cyclic compound
GO:0017148	negative regulation of translation
GO:0035640	exploration behavior
GO:0045727	positive regulation of translation
GO:0048701	embryonic cranial skeleton morphogenesis
GO:0051028	mRNA transport
GO:0072715	cellular response to selenite ion
GO:0090394	negative regulation of excitatory postsynaptic potential
GO:0099578	regulation of translation at postsynapse, modulating synaptic transmission
GO:1904570	negative regulation of selenocysteine incorporation
GO:1990416	cellular response to brain-derived neurotrophic factor stimulus
GO:2000622	regulation of nuclear-transcribed mRNA catabolic process, nonsense-mediated decay

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005681	spliceosomal complex
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0016020	membrane
GO:0016607	nuclear speck
GO:0030425	dendrite
GO:0035145	exon-exon junction complex
GO:0043025	neuronal cell body
GO:0071006	U2-type catalytic step 1 spliceosome
GO:0071013	catalytic step 2 spliceosome
GO:0098794	postsynapse
GO:0098978	glutamatergic synapse
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2xb2, PDBe:2xb2, PDBj:2xb2
PDBsum	2xb2
PubMed	20479275
UniProt	P38919\|IF4A3_HUMAN Eukaryotic initiation factor 4A-III (Gene Name=EIF4A3)

[Back to BioLiP]