Structure of PDB 2vb2 Chain X

Receptor sequence
>2vb2X (length=75) Species: 469008 (Escherichia coli BL21(DE3)) [Search protein sequence]
PQVISATGVVKGIDLESKKITIHHDPIAAVNWPEMTMRFTITPQTKMSEI
KTGDKVAFNFVQQGNLSLLQDIKVS
3D structure
PDB2vb2 Cu(I) Recognition Via Cation-Pi and Methionine Interactions in Cusf.
ChainX
Resolution1.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CU X H36 W44 M47 M49 H24 W32 M35 M37
Gene Ontology
Molecular Function
GO:0005507 copper ion binding
GO:0005515 protein binding
GO:0016530 metallochaperone activity
GO:0016531 copper chaperone activity
GO:0046872 metal ion binding
GO:0046914 transition metal ion binding
Biological Process
GO:0006878 intracellular copper ion homeostasis
GO:0009636 response to toxic substance
GO:0010043 response to zinc ion
GO:0010272 response to silver ion
GO:0010273 detoxification of copper ion
GO:0035434 copper ion transmembrane transport
GO:0046688 response to copper ion
GO:0060003 copper ion export
GO:1902601 silver ion transmembrane transport
Cellular Component
GO:0030288 outer membrane-bounded periplasmic space
GO:0042597 periplasmic space

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2vb2, PDBe:2vb2, PDBj:2vb2
PDBsum2vb2
PubMed18157124
UniProtP77214|CUSF_ECOLI Cation efflux system protein CusF (Gene Name=cusF)

[Back to BioLiP]