Structure of PDB 2rc0 Chain X

Receptor sequence

>2rc0X (length=292) Species: 307796 (Saccharomyces cerevisiae YJM789)

TLVHVASVEKGRSYEDFQKVYNAIALKLREDDEYDNYIGYGPVLVRLAWH
ISGTWDKHDNTGGSYGGTYRFKKEFNDPSNAGLQNGFKFLEPIHKEFPWI
SSGDLFSLGGVTAVQEMQGPKIPWRCGRVDTPEDTTPDNGRLPDADKDAG
YVRTFFQRLNMNDREVVALMGAHALGKTHLKNSGYEGPGGAANNVFTNEF
YLNLLNEDWKLEKNDANNEQWDSKSGYMMLPTDYSLIQDPKYLSIVKEYA
NDQDKFFKDFSKAFEKLLEDGITFPKDAPSPFIFKTLEEQGL

3D structure

• PDB: 2rc0 Rescoring docking hit lists for model cavity sites: predictions and experimental testing.
• Chain: X
• Resolution: 1.5 Å

Enzymatic activity

• Enzyme Commision number: 1.11.1.5: cytochrome-c peroxidase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	X	P44 R48 W51 P145 D146 A147 L171 M172 A174 H175 G178 K179 T180 H181 N184 S185 L232	P42 R46 W49 P143 D144 A145 L169 M170 A172 H173 G176 K177 T178 H179 N182 S183 L230
BS02	284	X	H175 G178 K179 T180 G191 M230 M231 L232 D235	H173 G176 K177 T178 G189 M228 M229 L230 D233

Gene Ontology

Molecular Function

• GO:0004601 peroxidase activity
• GO:0020037 heme binding

Biological Process

• GO:0006979 response to oxidative stress
• GO:0034599 cellular response to oxidative stress

External links

• PDB: RCSB:2rc0, PDBe:2rc0, PDBj:2rc0
• PDBsum: 2rc0
• PubMed: 18280498
• UniProt: P00431|CCPR_YEAST Cytochrome c peroxidase, mitochondrial (Gene Name=CCP1)