Structure of PDB 2qcp Chain X |
>2qcpX (length=80) Species: 316407 (Escherichia coli str. K-12 substr. W3110) [Search protein sequence] |
MEAQPQVISATGVVKGIDLESKKITIHHDPIAAVNWPEMTMRFTITPQTK MSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ |
|
PDB | 2qcp Unusual Cu(I)/Ag(I) coordination of Escherichia coli CusF as revealed by atomic resolution crystallography and X-ray absorption spectroscopy |
Chain | X |
Resolution | 1.0 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
AG |
X |
H36 W44 M47 M49 |
H28 W36 M39 M41 |
|
|
|