Structure of PDB 2cl7 Chain X

Receptor sequence

>2cl7X (length=166) Species: 9606 (Homo sapiens)

MTEYKLVVVGAGGVGKSALTIQLIQNHFVDECDPTIEDSYRKQVVIDGET
CLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQI
KRVKDSDDVPMVLVGNKSDLAARTVESRQAQDLARSYGIPYIETSAKTRQ
GVEDAFYTLVREIRQH

3D structure

• PDB: 2cl7 A Newly Designed Microspectrofluorometer for Kinetic Studies on Protein Crystals in Combination with X-Ray Diffraction.
• Chain: X
• Resolution: 1.25 Å

Enzymatic activity

• Enzyme Commision number: 3.6.5.2: small monomeric GTPase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MG	X	S17 T35	S17 T35
BS02	MG	X	D108 H166	D108 H166
BS03	GTP	X	G12 G13 G15 K16 S17 A18 F28 D30 T35 G60 N116 K117 D119 L120 S145	G12 G13 G15 K16 S17 A18 F28 D30 T35 G60 N116 K117 D119 L120 S145

Gene Ontology

Molecular Function

• GO:0003924 GTPase activity
• GO:0005525 GTP binding

Biological Process

• GO:0007165 signal transduction

Cellular Component

• GO:0016020 membrane

External links

• PDB: RCSB:2cl7, PDBe:2cl7, PDBj:2cl7
• PDBsum: 2cl7
• PubMed: 16698776
• UniProt: P01112|RASH_HUMAN GTPase HRas (Gene Name=HRAS)