Structure of PDB 1vqk Chain X

Receptor sequence
>1vqkX (length=82) Species: 2238 (Haloarcula marismortui) [Search protein sequence]
ERVVTIPLRDARAEPNHKRADKAMILIREHLAKHFSVDEDAVRLDPSINE
AAWARGRANTPSKIRVRAARFEEEGEAIVEAE
3D structure
PDB1vqk Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
ChainX
Resolution2.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna X T11 P13 R15 D16 R18 A19 P21 N22 H23 D27 K28 M30 K39 H40 R49 L50 P52 N55 E56 W59 R63 S68 T5 P7 R9 D10 R12 A13 P15 N16 H17 D21 K22 M24 K33 H34 R43 L44 P46 N49 E50 W53 R57 S62
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1vqk, PDBe:1vqk, PDBj:1vqk
PDBsum1vqk
PubMed16285925
UniProtP18138|RL31_HALMA Large ribosomal subunit protein eL31 (Gene Name=rpl31e)

[Back to BioLiP]