Structure of PDB 1ul1 Chain X

Receptor sequence
>1ul1X (length=313) Species: 9606 (Homo sapiens) [Search protein sequence]
GIQGLAKLIADVAPSAIRENDIKSYFGRKVAIDASMSIYQFLIAVTTSHL
MGMFYRTIRMMENGIKPVYVFDGKPPQLKSGELAKRLVKVTKQHNDECKH
LLSLMGIPYLDAPSEAEASCAALVKAGKVYAAATEDMDCLTFGSPVLMRH
LTASEKKLPIQEFHLSRILQELGLNQEQFVDLCILLGSDYCESIRGIGPK
RAVDLIQKHKSIEEIVRRLDPNKYPVPENWLHKEAHQLFLEPEVLDPESV
ELKWSEPNEEELIKFMCGEKQFSEERIRSGVKRLSKSRQGSTQGRLDDFF
KVTGSLSSAKRKE
3D structure
PDB1ul1 Structural basis for recruitment of human flap endonuclease 1 to PCNA
ChainX
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.1.-.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 MG X D86 E160 D72 E117
BS02 MG X E160 D181 E117 D138
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0003677 DNA binding
GO:0003684 damaged DNA binding
GO:0003690 double-stranded DNA binding
GO:0003824 catalytic activity
GO:0004518 nuclease activity
GO:0004519 endonuclease activity
GO:0004523 RNA-DNA hybrid ribonuclease activity
GO:0004527 exonuclease activity
GO:0005515 protein binding
GO:0008309 double-stranded DNA exodeoxyribonuclease activity
GO:0008409 5'-3' exonuclease activity
GO:0016788 hydrolase activity, acting on ester bonds
GO:0017108 5'-flap endonuclease activity
GO:0030145 manganese ion binding
GO:0046872 metal ion binding
GO:0048256 flap endonuclease activity
Biological Process
GO:0000724 double-strand break repair via homologous recombination
GO:0006260 DNA replication
GO:0006281 DNA repair
GO:0006284 base-excision repair
GO:0006287 base-excision repair, gap-filling
GO:0006302 double-strand break repair
GO:0007613 memory
GO:0009650 UV protection
GO:0032201 telomere maintenance via semi-conservative replication
GO:0043137 DNA replication, removal of RNA primer
GO:0045876 positive regulation of sister chromatid cohesion
GO:0090304 nucleic acid metabolic process
Cellular Component
GO:0000781 chromosome, telomeric region
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0005739 mitochondrion
GO:0016020 membrane
GO:0032991 protein-containing complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1ul1, PDBe:1ul1, PDBj:1ul1
PDBsum1ul1
PubMed15616578
UniProtP39748|FEN1_HUMAN Flap endonuclease 1 (Gene Name=FEN1)

[Back to BioLiP]