Structure of PDB 1q82 Chain X

Receptor sequence

>1q82X (length=154) Species: 2238 (Haloarcula marismortui) [Search protein sequence]

MHALVQLRGEVNMHTDIQDTLEMLNIHHVNHCTLVPETDAYRGMVAKVND
FVAFGEPSQETLETVLATRAEPLEGDADVDDEWVAEHTDYDDISGLAFAL
LSEETTLREQGLSPTLRLHPPRGGHDGVKHPVKEGGQLGKHDTEGIDDLL
EAMR

3D structure

PDB

1q82 Structural Insights Into Peptide Bond Formation

Chain

Resolution

2.98 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	X	G9 E10 V11 N12 H14 T15 D19 T20 M23 N25 H27 H28 V29 N30 H31 A40 Y41 G43 M44 K47 R69 E74 R108 P114 R117 L118 H119 P120 P121 R122 G123 G124 H125 G127 V128 K129 R154	G9 E10 V11 N12 H14 T15 D19 T20 M23 N25 H27 H28 V29 N30 H31 A40 Y41 G43 M44 K47 R69 E74 R108 P114 R117 L118 H119 P120 P121 R122 G123 G124 H125 G127 V128 K129 R154
BS02	rna	X	R8 H14 D50 K129 H130 P131 K133 E134	R8 H14 D50 K129 H130 P131 K133 E134

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0000463	maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1q82, PDBe:1q82, PDBj:1q82
PDBsum	1q82
PubMed	12185246
UniProt	P14121\|RL30_HALMA Large ribosomal subunit protein uL30 (Gene Name=rpl30)

[Back to BioLiP]