Structure of PDB 1ffk Chain X

Receptor sequence
>1ffkX (length=56) Species: 2238 (Haloarcula marismortui) [Search protein sequence]
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEW
QSKAGE
3D structure
PDB1ffk The complete atomic structure of the large ribosomal subunit at 2.4 A resolution.
ChainX
Resolution2.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna X G2 A3 G9 R20 K44 K53 G2 A3 G9 R20 K44 K53
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0008270 zinc ion binding
GO:0019843 rRNA binding
GO:0046872 metal ion binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1ffk, PDBe:1ffk, PDBj:1ffk
PDBsum1ffk
PubMed10937989
UniProtP32410|RL37_HALMA Large ribosomal subunit protein eL37 (Gene Name=rpl37e)

[Back to BioLiP]