Structure of PDB 8rd8 Chain WD

Receptor sequence
>8rd8WD (length=76) Species: 45610 (Psychrobacter urativorans) [Search protein sequence]
SRVCQVTGKRPMVGNNVSHANNKTRRRFLPNLHHHRFWVESENRFVRLRI
STKGMRIIDKLGIDKVLVDLRAQGQK
3D structure
PDB8rd8 A new family of bacterial ribosome hibernation factors
ChainWD
Resolution2.62 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna WD S2 R3 K10 R11 M13 V14 G15 N16 S19 H20 A21 N22 N23 K24 R26 R27 R28 F29 L30 P31 N32 H34 H36 R37 R48 R50 T53 K54 R57 K61 L62 S1 R2 K9 R10 M12 V13 G14 N15 S18 H19 A20 N21 N22 K23 R25 R26 R27 F28 L29 P30 N31 H33 H35 R36 R47 R49 T52 K53 R56 K60 L61
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8rd8, PDBe:8rd8, PDBj:8rd8
PDBsum8rd8
PubMed38355796
UniProtA0A0M4T6Y7

[Back to BioLiP]