Structure of PDB 6bok Chain WA

Receptor sequence
>6bokWA (length=88) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHH
SHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
3D structure
PDB6bok Conformational Control of Translation Termination on the 70S Ribosome.
ChainWA
Resolution3.55 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna WA P2 K5 K8 F18 T22 G23 Q28 L31 R35 R38 H42 H46 K48 D49 H50 H51 S52 H53 R54 G55 M58 G61 Q62 R64 R65 Y69 P1 K4 K7 F17 T21 G22 Q27 L30 R34 R37 H41 H45 K47 D48 H49 H50 S51 H52 R53 G54 M57 G60 Q61 R63 R64 Y68
BS02 rna WA S40 H53 L56 V60 G89 S39 H52 L55 V59 G88
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6bok, PDBe:6bok, PDBj:6bok
PDBsum6bok
PubMed29731232
UniProtP62657|RS15_THET2 Small ribosomal subunit protein uS15 (Gene Name=rpsO)

[Back to BioLiP]