Structure of PDB 5y6p Chain W5

Receptor sequence
>5y6pW5 (length=227) Species: 35689 (Griffithsia pacifica) [Search protein sequence]
SIPVLNYSLSTQNQRVYSFEYLPNEEQPKCYTTDNLPAAIEMDQIIWAAY
RQIFSEHQLLSSTRQPFLESQLRFNQITVKDFIKGLILSDAFRYLNYDVN
NNYRFVEMCIQRILGREIYNHREKLAFAVIIGSQGLEAFIDLLINSEEYE
DNFGDNMIPYQRRRIIAQRSKGEIPFNLKTPRLGKDFLYKQGMPQLLWAG
PVHRFRPQEQSPKAGDPALFLSMVQDL
3D structure
PDB5y6p Structure of phycobilisome from the red alga Griffithsia pacifica
ChainW5
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 PEB W5 N14 R16 V17 R170 N13 R15 V16 R169
BS02 PEB W5 L6 Y104 L126 A127 V130 L5 Y103 L125 A126 V129
BS03 PEB W5 H58 P182 H57 P181
BS04 PEB W5 S71 F75 S70 F74
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Thu Nov 28 14:54:55 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '5y6p', asym_id = 'W5', title = 'Structure of phycobilisome from the red alga Griffithsia pacifica'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='5y6p', asym_id='W5', title='Structure of phycobilisome from the red alga Griffithsia pacifica')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0015979,0030089', uniprot = '', pdbid = '5y6p', asym_id = 'W5'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0015979,0030089', uniprot='', pdbid='5y6p', asym_id='W5')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>