Structure of PDB 7a5g Chain W3

Receptor sequence
>7a5gW3 (length=111) Species: 9606 (Homo sapiens) [Search protein sequence]
SSKNLGGKSSGRRQGIKKMEGHYVHAGNIIATQRHFRWHPGAHVGVGKNK
CLYALEEGIVRYTKEVYVPHPRNTEAVDLITRLPKGAVLYKTFVHVVPAK
PEGTFKLVAML
3D structure
PDB7a5g Elongational stalling activates mitoribosome-associated quality control.
ChainW3
Resolution4.33 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna W3 N41 G43 S46 G48 R49 R50 I53 K54 M56 E57 H59 A63 G64 N65 I66 R71 H72 R74 W75 G84 K85 N86 Y99 K101 N4 G6 S9 G11 R12 R13 I16 K17 M19 E20 H22 A26 G27 N28 I29 R34 H35 R37 W38 G47 K48 N49 Y62 K64
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7a5g, PDBe:7a5g, PDBj:7a5g
PDBsum7a5g
PubMed33243891
UniProtQ9P0M9|RM27_HUMAN Large ribosomal subunit protein bL27m (Gene Name=MRPL27)

[Back to BioLiP]