Structure of PDB 5y6p Chain W3

Receptor sequence
>5y6pW3 (length=164) Species: 35689 (Griffithsia pacifica) [Search protein sequence]
MKSVITTTISAADAAGRFPSSSDLESIQGNIQRASARLEAAEKLSGNHEA
VVKEAGDACFAKYSYLKNSGEAGDSQEKINKCYRDVDHYMRLINYSLVVG
GTGPLDEWGIAGSREVYRTLNLPGSAYIASFTFTRDRLCVPRDMSSQAGV
EFVAALDYVINSLS
3D structure
PDB5y6p Structure of phycobilisome from the red alga Griffithsia pacifica
ChainW3
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 PEB W3 R33 Q147 E151 R33 Q147 E151
BS02 PEB W3 A72 G73 K78 K81 C82 R84 D85 H88 Y89 Y117 A72 G73 K78 K81 C82 R84 D85 H88 Y89 Y117
BS03 PEB W3 K43 L44 N47 R137 C139 D143 K43 L44 N47 R137 C139 D143
BS04 PEB W3 L24 E25 Q28 L24 E25 Q28
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sun Dec 1 08:05:04 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '5y6p', asym_id = 'W3', title = 'Structure of phycobilisome from the red alga Griffithsia pacifica'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='5y6p', asym_id='W3', title='Structure of phycobilisome from the red alga Griffithsia pacifica')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0015979,0030089', uniprot = '', pdbid = '5y6p', asym_id = 'W3'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0015979,0030089', uniprot='', pdbid='5y6p', asym_id='W3')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>