Structure of PDB 8x1c Chain W

Receptor sequence
>8x1cW (length=187) Species: 9606 (Homo sapiens) [Search protein sequence]
GVTIVKPIVYGNVARYFGKKREEDGHTHQWTVYVKPYRNEDMSAYVKKIQ
FKLHESYGNPLRVVTKPPYEITETGWGEFEIIIKIFFIDPNERPVTLYHL
LKLFQSDTNAMLGKKTVVSEFYDEMIFQDPTAMMQQLLTTSRQLTLGAYK
HETEFAELEVKTREKLEAAKKKTSFEIAELKERLKAS
3D structure
PDB8x1c Structure of nucleosome-bound SRCAP-C in the ADP-bound state
ChainW
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna W R38 E39 E40 D41 R21 E22 E23 D24
Gene Ontology
Molecular Function
GO:0005200 structural constituent of cytoskeleton
GO:0005515 protein binding
GO:0042393 histone binding
GO:0070577 lysine-acetylated histone binding
GO:0140030 modification-dependent protein binding
Biological Process
GO:0000278 mitotic cell cycle
GO:0006325 chromatin organization
GO:0006338 chromatin remodeling
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II
GO:0007010 cytoskeleton organization
GO:0042981 regulation of apoptotic process
GO:0045893 positive regulation of DNA-templated transcription
GO:0051726 regulation of cell cycle
GO:1905168 positive regulation of double-strand break repair via homologous recombination
GO:2000779 regulation of double-strand break repair
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0016363 nuclear matrix
GO:0031965 nuclear membrane
GO:0035267 NuA4 histone acetyltransferase complex
GO:0043231 intracellular membrane-bounded organelle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8x1c, PDBe:8x1c, PDBj:8x1c
PDBsum8x1c
PubMed38331872
UniProtO95619|YETS4_HUMAN YEATS domain-containing protein 4 (Gene Name=YEATS4)

[Back to BioLiP]