Structure of PDB 8wlq Chain W |
>8wlqW (length=132) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search protein sequence] |
LLNIFDIAGSALAAQSKRLNVAASNLANADSVTGPDGQPYRAKQVVFQVD AAPGQATGGVKVASVIESQAPEKLVYEPGNPLADANGYVKMPNVDVVGEM VNTMSASRSYQANIEVLNTVKSMMLKTLTLGQ |
|
PDB | 8wlq Cryo-EM structure of the whole rod-export apparatus with hook within the flagellar motor-hook complex in the CCW state. |
Chain | W |
Resolution | 3.8 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
W |
Q46 V47 N104 |
Q44 V45 N102 |
|
|
|