Structure of PDB 8wln Chain W |
>8wlnW (length=132) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search protein sequence] |
LLNIFDIAGSALAAQSKRLNVAASNLANADSVTGPDGQPYRAKQVVFQVD AAPGQATGGVKVASVIESQAPEKLVYEPGNPLADANGYVKMPNVDVVGEM VNTMSASRSYQANIEVLNTVKSMMLKTLTLGQ |
|
PDB | 8wln Cryo-EM structure of the MS ring with export apparatus and proximal rod within the motor-hook complex in the CCW state |
Chain | W |
Resolution | 4.3 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
W |
Q46 V47 N104 |
Q44 V45 N102 |
|
|
|