Structure of PDB 8whx Chain W

Receptor sequence
>8whxW (length=97) Species: 246196 (Mycolicibacterium smegmatis MC2 155) [Search protein sequence]
ATITDPRDIILAPVISEKSYGLIEDNVYTFVVHPDSNKTQIKIAIEKIFD
VKVDSVNTANRQGKRKRTRTGFGKRKSTKRAIVKLAAGSKPIDLFGA
3D structure
PDB8whx Cryo- EM structure of the mycobacterial 70S ribosome in complex with ribosome hibernation promotion factor RafH.
ChainW
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna W T5 S17 K19 H34 N38 K39 T40 Q41 K43 N58 T59 N61 R62 K65 R66 R68 R70 T71 G74 R76 K77 S78 K80 I83 T4 S16 K18 H33 N37 K38 T39 Q40 K42 N57 T58 N60 R61 K64 R65 R67 R69 T70 G73 R75 K76 S77 K79 I82
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8whx, PDBe:8whx, PDBj:8whx
PDBsum8whx
PubMed38245551
UniProtA0QSD3|RL23_MYCS2 Large ribosomal subunit protein uL23 (Gene Name=rplW)

[Back to BioLiP]