Structure of PDB 8wdu Chain W

Receptor sequence
>8wduW (length=50) Species: 572477 (Allochromatium vinosum DSM 180) [Search protein sequence]
SPDLWKIWLLVDPRRILIAVFAFLTVLGLAIHMILLSTAEFNWLEDGVPA
3D structure
PDB8wdu High-resolution structure and biochemical properties of the LH1-RC photocomplex from the model purple sulfur bacterium, Allochromatium vinosum
ChainW
Resolution2.24 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 UQ8 W L30 M34 L29 M33
BS02 CRT W L30 H33 L29 H32
BS03 BCL W F22 H33 W44 F21 H32 W43
BS04 CA W W44 D47 V49 W43 D46 V48
BS05 BCL W L25 L28 G29 I32 H33 F42 L24 L27 G28 I31 H32 F41
BS06 CRT W L18 V21 F24 L25 L28 L17 V20 F23 L24 L27
BS07 CRT W K7 I8 L11 K6 I7 L10
Gene Ontology
Molecular Function
GO:0042314 bacteriochlorophyll binding
GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872 metal ion binding
Biological Process
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0019866 organelle inner membrane
GO:0030076 light-harvesting complex
GO:0030077 plasma membrane light-harvesting complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8wdu, PDBe:8wdu, PDBj:8wdu
PDBsum8wdu
PubMed38347078
UniProtD3RP74

[Back to BioLiP]