Structure of PDB 8v84 Chain W

Receptor sequence
>8v84W (length=232) Species: 1247190 (Saccharomyces cerevisiae BY4741) [Search protein sequence]
RSKRSKLVTLAQTDKKGRENKERIFDEVREALDTYRYVWVLHLDDVRTPV
LQEIRTSWAGSKLIMGKRKVLQKALGEKREEEYKENLYQLSKLCSGVTGL
LFTDEDVNTVKEYFKSYVRSDYSRPNTKAPLTFTIPEGIVYSRGGQIPAE
EDVPMIHSLEPTMRNKFEIPTKIKAGKITIDSPYLVCTEGEKLDVRQALI
LKQFGIAASEFKVKVSAYYDNDSSTVESTNIN
3D structure
PDB8v84 The DEAD-box ATPase Dbp10/DDX54 initiates peptidyl transferase center formation during 60S ribosome biogenesis.
ChainW
Resolution2.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna W R3 S4 K5 R6 K8 T11 A13 Q14 T15 D16 K18 R20 K23 E24 R49 T50 Q54 R57 M67 K69 R70 K71 V72 K75 V99 S160 R1 S2 K3 R4 K6 T9 A11 Q12 T13 D14 K16 R18 K21 E22 R47 T48 Q52 R55 M65 K67 R68 K69 V70 K73 V97 S158
Gene Ontology
Molecular Function
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0000055 ribosomal large subunit export from nucleus
GO:0000956 nuclear-transcribed mRNA catabolic process
GO:0006364 rRNA processing
GO:0030490 maturation of SSU-rRNA
GO:0042254 ribosome biogenesis
GO:0042273 ribosomal large subunit biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0030687 preribosome, large subunit precursor
GO:0032040 small-subunit processome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8v84, PDBe:8v84, PDBj:8v84
PDBsum8v84
PubMed38632236
UniProtP33201|MRT4_YEAST Ribosome assembly factor MRT4 (Gene Name=MRT4)

[Back to BioLiP]