Structure of PDB 8s1p Chain W

Receptor sequence

>8s1pW (length=80) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168)

GVGSTKNGRDSEAKRLGAKRADGQFVTGGSILYRQRGTKIYPGENVGRGG
DDTLFAKIDGTVKFERFGRDRKKVSVYPVA

3D structure

• PDB: 8s1p A role for the S4-domain containing protein YlmH in ribosome-associated quality control in Bacillus subtilis.
• Chain: W
• Resolution: 1.96 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	W	S17 T18 N20 R22 D23 S24 E25 A26 K27 R28 L29 K32 R33 A34 D35 G36 Q37 T40 G41 G42 S43 I44 Y46 R47 R49 G50 T51 K52 Y54 G62 G63 D64 D65 T66 F68 K70 F77 R84 K85	S4 T5 N7 R9 D10 S11 E12 A13 K14 R15 L16 K19 R20 A21 D22 G23 Q24 T27 G28 G29 S30 I31 Y33 R34 R36 G37 T38 K39 Y41 G49 G50 D51 D52 T53 F55 K57 F64 R71 K72
BS02	rna	W	R79 G81 R82	R66 G68 R69

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8s1p, PDBe:8s1p, PDBj:8s1p
• PDBsum: 8s1p
• PubMed: 38811035
• UniProt: P05657|RL27_BACSU Large ribosomal subunit protein bL27 (Gene Name=rpmA)