Structure of PDB 8qfd Chain W

Receptor sequence
>8qfdW (length=62) Species: 9606 (Homo sapiens) [Search protein sequence]
MKVELCSFSGYKIYPGHGRRYARTDGKVFQFLNAKCESAFLSKRNPRQIN
WTVLYRRKHKKG
3D structure
PDB8qfd The UFM1 E3 ligase recognizes and releases 60S ribosomes from ER translocons
ChainW
Resolution2.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna W G16 G18 K35 R44 I49 N50 W51 R56 K61 G16 G18 K35 R44 I49 N50 W51 R56 K61
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0045296 cadherin binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0010458 exit from mitosis
GO:0021554 optic nerve development
GO:0031290 retinal ganglion cell axon guidance
GO:0060041 retina development in camera-type eye
Cellular Component
GO:0005737 cytoplasm
GO:0005783 endoplasmic reticulum
GO:0005829 cytosol
GO:0005840 ribosome
GO:0016020 membrane
GO:0022625 cytosolic large ribosomal subunit
GO:0022626 cytosolic ribosome
GO:0045202 synapse
GO:0070062 extracellular exosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8qfd, PDBe:8qfd, PDBj:8qfd
PDBsum8qfd
PubMed38383789
UniProtP83731|RL24_HUMAN Large ribosomal subunit protein eL24 (Gene Name=RPL24)

[Back to BioLiP]