Structure of PDB 8qcq Chain W

Receptor sequence

>8qcqW (length=85) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168)

ASKKGVGSTKNGRDSEAKRLGAKRADGQFVTGGSILYRQRGTKIYPGENV
GRGGDDTLFAKIDGTVKFERFGRDRKKVSVYPVAQ

3D structure

• PDB: 8qcq Novel arrest peptides induce ribosome stalling by short circuiting the ribosomal peptidyltransferase activity
• Chain: W
• Resolution: 2.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	W	A10 S11 K12 S17 T18 N20 R22 D23 S24 E25 A26 K27 R28 L29 K32 R33 A34 D35 G36 Q37 G41 G42 S43 I44 Y46 R47 R49 G50 T51 K52 Y54 G62 G63 D64 D65 T66 F68 F77 R84 K85	A1 S2 K3 S8 T9 N11 R13 D14 S15 E16 A17 K18 R19 L20 K23 R24 A25 D26 G27 Q28 G32 G33 S34 I35 Y37 R38 R40 G41 T42 K43 Y45 G53 G54 D55 D56 T57 F59 F68 R75 K76
BS02	rna	W	R79 R82	R70 R73
BS03	rna	W	A10 G14 V15	A1 G5 V6

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8qcq, PDBe:8qcq, PDBj:8qcq
• PDBsum: 8qcq
• PubMed: 38503735
• UniProt: P05657|RL27_BACSU Large ribosomal subunit protein bL27 (Gene Name=rpmA)