Structure of PDB 8q5i Chain W |
>8q5iW (length=87) Species: 5476 (Candida albicans) [Search protein sequence] |
MENDKGQLVELYVPRKCSATNRIIKAKDHASVQISIAKVDEDGRAIAGEN ITYALSGYVRGRGEADDSLNRLAQQDGLLKNVWSYSR |
|
PDB | 8q5i Structural characterization of cephaeline binding to the eukaryotic ribosome using Cryo-Electron Microscopy |
Chain | W |
Resolution | 2.45 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
W |
Y58 R62 |
Y58 R62 |
|
|
|
Biological Process |
GO:0000447 |
endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) |
GO:0000461 |
endonucleolytic cleavage to generate mature 3'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA) |
GO:0006364 |
rRNA processing |
GO:0006412 |
translation |
|
|