Structure of PDB 8ovj Chain W

Receptor sequence

>8ovjW (length=118) Species: 347515 (Leishmania major strain Friedlin) [Search protein sequence]

KCGSRRKARRAHFQAPSHVRRVLMSAPLSKELRAKYNVRAMPVRKDDEVI
VKRGTFKGREGKVTACYRLKWVILIDKVNREKANGSTVAVGIHPSNVEIT
KLKLTHHRKSILERKDRS

3D structure

PDB

8ovj Structural and mechanistic insights into the function of Leishmania ribosome lacking a single pseudouridine modification.

Chain

Resolution

2.4 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	W	K5 C6 G7 R9 R13 L27 P31 R43 R57 G58 T59 R84 K86 A87 N100 R118 R121	K1 C2 G3 R5 R9 L23 P27 R39 R53 G54 T55 R80 K82 A83 N96 R114 R117
BS02	rna	W	R10 R13 R14 F17 Q18 S21 H22 R25 K49 Y71 R72 H110 R118	R6 R9 R10 F13 Q14 S17 H18 R21 K45 Y67 R68 H106 R114

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0042273	ribosomal large subunit biogenesis

	Cellular Component
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:0031981	nuclear lumen
GO:0097014	ciliary plasm

External links