Structure of PDB 8om3 Chain W

Receptor sequence

>8om3W (length=402) Species: 4932 (Saccharomyces cerevisiae)

KRVTPGSLYKNWTNTTHTAQLQQTAVPLALPIFNFDDISKTLNKVVSYSN
KQYKSLHHLGSFKKSQFNELFQKPVCLVREDATNSFLKKLVSHPVKKFII
TGEPGVGKTVLLSQAHAYAVDSKQIIINISYPELFLNGRNDFSYDDDLKL
FIQPMYLKKLIRKILKANDPALLKSIELSKDYKFSNANPKNASVKPFVTL
NKTKNTVLDLLSVMTHPHNRGKLMKAIIDELSVQSKVPIMFTVDNFSKVL
TTAYSAYRNTENKQIYSLDLQMGKLMMDIISGETKFANGESSTILAISGV
DRTNKTLPVALGKIPVDPYVTRYHYEPKFVELLQKGNVTEFEVPKLNKQE
VNELIDYYKQSNVLLDKDITGKKWENLIDEKYFLSGNGNPRELLKSLVLS
HR

3D structure

• PDB: 8om3 METTL17 is an Fe-S cluster checkpoint for mitochondrial translation.
• Chain: W
• Resolution: 2.87 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	W	K49 V51 Y57 K58 T66 Q68 N98 K102 H105 H106 G108 K111 K112 K121 S178 Y179 R187 M203 K206 R210 K211 Y302 K311 V348 T351 K353 T369 R370 Y371 H372	K1 V3 Y9 K10 T18 Q20 N50 K54 H57 H58 G60 K63 K64 K73 S130 Y131 R139 M155 K158 R162 K163 Y254 K263 V300 T303 K305 T321 R322 Y323 H324
BS02	ATP	W	Q114 C124 L125 G153 G155 K156 T157 V158 S346 G347 P438 R439	Q66 C76 L77 G105 G107 K108 T109 V110 S298 G299 P390 R391

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0005524 ATP binding
• GO:0005525 GTP binding

Biological Process

• GO:0032543 mitochondrial translation

Cellular Component

• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0005763 mitochondrial small ribosomal subunit
• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8om3, PDBe:8om3, PDBj:8om3
• PDBsum: 8om3
• PubMed: 38199006
• UniProt: Q01163|RT23_YEAST Small ribosomal subunit protein mS29 (Gene Name=RSM23)