Structure of PDB 8i7j Chain W

Receptor sequence

>8i7jW (length=129) Species: 284590 (Kluyveromyces lactis NRRL Y-1140) [Search protein sequence]

TRTSVLADALNAINNAEKTGKRQVLIRPSSKVIIKFLQVMQKHGYIGEFE
YIDDHRSGKIVVQLNGRLNKCGVISPRFNVKIADVEKWTANLLPARQFGY
VILTTSAGIMDHEEAHRKHVSGKILGFVY

3D structure

PDB

8i7j Yeast eukaryotic initiation factor 4B remodels the mRNA entry site on the small ribosomal subunit

Chain

Resolution

4.6 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	W	T2 R3 V6 D9 N12 A13 N16 T20 K22 R28 S31 K32 R57 K60 K71 I75 S76 N80 K82 I83 K88 L93 T105 T106 S107 E115 R118 K119 H120 S122 Y130	T1 R2 V5 D8 N11 A12 N15 T19 K21 R27 S30 K31 R56 K59 K70 I74 S75 N79 K81 I82 K87 L92 T104 T105 S106 E114 R117 K118 H119 S121 Y129

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:8i7j, PDBe:8i7j, PDBj:8i7j
PDBsum	8i7j
PubMed
UniProt	Q6CW21\|RS22_KLULA Small ribosomal subunit protein uS8 (Gene Name=RPS22)