Structure of PDB 8ea4 Chain W

Receptor sequence

>8ea4W (length=514) Species: 34078 (Scytonema hofmannii)

LEKNVIATQLSEEAQVKLEVIQSLLEPCDRTTYGQKLREAAEKLNVSLRT
VQRLVKNWEQDGLVGLTQTSRADKGKHRIGEFWENFITKTYKEGNKGSKR
MTPKQVALRVEAKARELKDSKPPNYKTVLRVLAPILEKQQKAKSIRSPGW
RGTTLSVKTREGKDLSVDYSNHVWQCDHTRVDVLLVDQHGEILSRPWLTT
VIDTYSRCIMGINLGFDAPSSGVVALALRHAILPKRYGSEYKLHCEWGTY
GKPEHFYTDGGKDFRSNHLSQIGAQLGFVCHLRDRPSEGGVVERPFKTLN
DQLFSTLPGYTGSNVQERPEDAEKDARLTLRELEQLLVRYIVDRYNQSID
ARMGDQTRFERWEAGLPTVPVPIPERDLDICLMKQSRRTVQRGGCLQFQN
LMYRGEYLAGYAGETVNLRFDPRDITTILVYRQENNQEVFLTRAHAQGLE
TEQLALDEAEAASRRLRTAGKTISNQSLLQEVVDRDALVATKKSRKERQK
LEQTVLRSAAVDES

3D structure

• PDB: 8ea4 Structures of the holo CRISPR RNA-guided transposon integration complex.
• Chain: W
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	W	R58 R77 K84 R99 D101 K102 G103 K104 H105 R106 I107 N152 K154 T155 R158 A246 K290 N295 R420	R30 R49 K56 R71 D73 K74 G75 K76 H77 R78 I79 N124 K126 T127 R130 A218 K262 N267 R392
BS02	dna	W	V74 S75 T78 R81 R99 A100 R106 P131 K132 Y153 K154	V46 S47 T50 R53 R71 A72 R78 P103 K104 Y125 K126
BS03	dna	W	D287 G288 G289 K290 R293 R416 T417 Q419 Q425 F426 N428 R495	D259 G260 G261 K262 R265 R388 T389 Q391 Q397 F398 N400 R467
BS04	dna	W	R174 R208 R223 P314 S315 E321 K325 S341 V343 R346	R146 R180 R195 P286 S287 E293 K297 S313 V315 R318
BS05	dna	W	S175 P176 G177 W178 R179 R235 S315 G318 V319 R322 T326 R380 R386	S147 P148 G149 W150 R151 R207 S287 G290 V291 R294 T298 R352 R358
BS06	MG	W	D205 D287	D177 D259

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding

Biological Process

• GO:0015074 DNA integration

External links

• PDB: RCSB:8ea4, PDBe:8ea4, PDBj:8ea4
• PDBsum: 8ea4
• PubMed: 36442503
• UniProt: A0A979HMQ2