Structure of PDB 8ea3 Chain W

Receptor sequence

>8ea3W (length=514) Species: 34078 (Scytonema hofmannii)

LEKNVIATQLSEEAQVKLEVIQSLLEPCDRTTYGQKLREAAEKLNVSLRT
VQRLVKNWEQDGLVGLTQTSRADKGKHRIGEFWENFITKTYKEGNKGSKR
MTPKQVALRVEAKARELKDSKPPNYKTVLRVLAPILEKQQKAKSIRSPGW
RGTTLSVKTREGKDLSVDYSNHVWQCDHTRVDVLLVDQHGEILSRPWLTT
VIDTYSRCIMGINLGFDAPSSGVVALALRHAILPKRYGSEYKLHCEWGTY
GKPEHFYTDGGKDFRSNHLSQIGAQLGFVCHLRDRPSEGGVVERPFKTLN
DQLFSTLPGYTGSNVQERPEDAEKDARLTLRELEQLLVRYIVDRYNQSID
ARMGDQTRFERWEAGLPTVPVPIPERDLDICLMKQSRRTVQRGGCLQFQN
LMYRGEYLAGYAGETVNLRFDPRDITTILVYRQENNQEVFLTRAHAQGLE
TEQLALDEAEAASRRLRTAGKTISNQSLLQEVVDRDALVATKKSRKERQK
LEQTVLRSAAVDES

3D structure

• PDB: 8ea3 Structures of the holo CRISPR RNA-guided transposon integration complex.
• Chain: W
• Resolution: 3.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	W	R66 R77 R99 K102 G103 K104 H105 R106 I107 N152 T155 R158 A246 K290 N295 R420	R38 R49 R71 K74 G75 K76 H77 R78 I79 N124 T127 R130 A218 K262 N267 R392
BS02	dna	W	D287 G288 G289 K290 R293 R416 T417 Q425 F426 N428 R495	D259 G260 G261 K262 R265 R388 T389 Q397 F398 N400 R467
BS03	dna	W	V74 S75 T78 R81 R99 R106 K132 Y153	V46 S47 T50 R53 R71 R78 K104 Y125
BS04	dna	W	R208 R223 P314 S315 E321 K325 S341 N342 V343 R346	R180 R195 P286 S287 E293 K297 S313 N314 V315 R318
BS05	dna	W	R174 S175 P176 G177 W178 R179 S315 G318 R322 R380 R386	R146 S147 P148 G149 W150 R151 S287 G290 R294 R352 R358
BS06	MG	W	D205 D287	D177 D259

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding

Biological Process

• GO:0015074 DNA integration

External links

• PDB: RCSB:8ea3, PDBe:8ea3, PDBj:8ea3
• PDBsum: 8ea3
• PubMed: 36442503
• UniProt: A0A979HMQ2