Structure of PDB 8d8l Chain W

Receptor sequence

>8d8lW (length=395) Species: 4932 (Saccharomyces cerevisiae)

LYKNWTNTTHTAQLQQTAVPLALPIFNFDDISKTLNKVVSYSNKQYKSLH
HLGSFKKSQFNELFQKPVCLVREDATNSFLKKLVSHPVKKFIITGEPGVG
KTVLLSQAHAYAVDSKQIIINISYPELFLNGRNDFSYDDDLKLFIQPMYL
KKLIRKILKANDPALLKSIELSKDYKFSNANPKNASVKPFVTLNKTKNTV
LDLLSVMTHPHNRGKLMKAIIDELSVQSKVPIMFTVDNFSKVLTTAYSAY
RNTENKQIYSLDLQMGKLMMDIISGETKFANGESSTILAISGVDRTNKTL
PVALGKIPVDPYVTRYHYEPKFVELLQKGNVTEFEVPKLNKQEVNELIDY
YKQSNVLLDKDITGKKWENLIDEKYFLSGNGNPRELLKSLVLSHR

3D structure

• PDB: 8d8l Principles of mitoribosomal small subunit assembly in eukaryotes.
• Chain: W
• Resolution: 2.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	W	Y57 K58 H65 T66 Q68 N98 Y101 K102 H105 H106 G108 K111 K112 S178 Y179 R187 M203 K206 R210 K211 M262 Y302 K311 V348 T351 K353 T369 R370 Y371 H372	Y2 K3 H10 T11 Q13 N43 Y46 K47 H50 H51 G53 K56 K57 S123 Y124 R132 M148 K151 R155 K156 M207 Y247 K256 V293 T296 K298 T314 R315 Y316 H317
BS02	ATP	W	Q114 L125 G153 G155 K156 T157 V158 S346 G347 P438 R439	Q59 L70 G98 G100 K101 T102 V103 S291 G292 P383 R384

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0005524 ATP binding
• GO:0005525 GTP binding

Biological Process

• GO:0032543 mitochondrial translation

Cellular Component

• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0005763 mitochondrial small ribosomal subunit
• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8d8l, PDBe:8d8l, PDBj:8d8l
• PDBsum: 8d8l
• PubMed: 36482135
• UniProt: Q01163|RT23_YEAST Small ribosomal subunit protein mS29 (Gene Name=RSM23)